| Basic Information | |
|---|---|
| Taxon OID | 3300004901 Open in IMG/M |
| Scaffold ID | Ga0068517_1029558 Open in IMG/M |
| Source Dataset Name | Wastewater microbial communities from Nanji, Korea with extracellular vesicles - Nanji-EVs |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Chunlab, Inc |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 568 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Engineered → Wastewater → Unclassified → Unclassified → Unclassified → Wastewater → Marine And Wastewater Microbial Communities From Korea, With Extracellular Vesicles |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Nanji, South Korea | |||||||
| Coordinates | Lat. (o) | 37.3132 | Long. (o) | 126.828 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F045749 | Metagenome / Metatranscriptome | 152 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0068517_10295581 | F045749 | N/A | LLLTNYKDALPITNDDRRFCVMYGRIQNEQELFDYFGGRDAASDYFETLFSESEKHAGALKTYLLNHKISEDFKPQGRAPDTESRKQMIQATISPEQCSVEDLINKHDCAVINGLILDVTWLAKQCEIDGEMLPPTRTLGHILSDMGYQQIENRRVFVKKTNSQHYVWFKPSKKTDSDFAKSEVIDFFK |
| ⦗Top⦘ |