NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0071103_108587

Scaffold Ga0071103_108587


Overview

Basic Information
Taxon OID3300004870 Open in IMG/M
Scaffold IDGa0071103_108587 Open in IMG/M
Source Dataset NameMid-Atlantic Ridge North Pond Expedition - Sample Bottom Water CTD 2012
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterThe Marine Biological Laboratory
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1668
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Abyssal Plane → Marine → Deep Marine Subsurface Microbial Communities From Mid-Atlantic Ridge (Iodp Expedition 336)

Source Dataset Sampling Location
Location NameNorth Pond, Atlantic Ocean
CoordinatesLat. (o)22.78Long. (o)-46.09Alt. (m)Depth (m)4350
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004642Metagenome / Metatranscriptome429Y

Sequences

Protein IDFamilyRBSSequence
Ga0071103_1085871F004642N/AMDNPAFSETVPNELRELGYVPPIIKSYDKNGINVWLDKRRKWYDVPFWQFTMDGVQWMVLDERHGSASQFYSHYKLAKGHVICTGLGFGTREQWLASKPEVTKITVLEKFKEVIDYHKDIGTKWSDKIEIINCDANDYKGSCDFLSIDHYEYDDVLRILDSIKKVCNNITCENTWFWMLEPWIRLGYITDNTENPTIIPKKIRYDGKENDILENYSKIKTYFEHVK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.