Scaffold Ga0071103_102612

Overview

Basic Information

• Taxon OID: 3300004870
• Scaffold ID: Ga0071103_102612
• Source Dataset Name: Mid-Atlantic Ridge North Pond Expedition - Sample Bottom Water CTD 2012
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: The Marine Biological Laboratory
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 3553
• Total Scaffold Genes: 7
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 4 (57.14%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Abyssal Plane → Marine → Deep Marine Subsurface Microbial Communities From Mid-Atlantic Ridge (Iodp Expedition 336)

Source Dataset Sampling Location

• Location Name: North Pond, Atlantic Ocean
• Coordinates
  • Lat. (^o): 22.78
  • Long. (^o): -46.09
  • Depth (m): 4350

Associated Families

Family	Category	Number of Sequences	3D Structure?
F008498	Metagenome / Metatranscriptome	332	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0071103_1026123	F008498	GGA	MATITYKNQPAIEKTKGSVPLAGTSHIYTVKKRLWNDSIEDVLQSLFKGTVLHLCCGVSRLGDVRVDSDITHSPDIVCDASDTKEYIKNGEFDTVLCDPPYNGKFQWNHDLLAELPRVAKKRIIFQHWFLPCDSLGRYKKNHTFLLKELLCWQPKTYFGRVQMISIFDKKIE*