Scaffold Ga0069134_173136

Overview

Basic Information

• Taxon OID: 3300004831
• Scaffold ID: Ga0069134_173136
• Source Dataset Name: Marine surface microbial communities from the North Atlantic Ocean - filtered matter
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Molecular Research LP (MR DNA)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1054
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (75.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Coastal → Unclassified → Surface Seawater → Marine Surface Microbial Communities From The North Atlantic Ocean, Enriched With Methanesulfonate

Source Dataset Sampling Location

• Location Name: Leca da Palmeira, Matosinhos
• Coordinates
  • Lat. (^o): 41.226956
  • Long. (^o): -8.720528
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F093695	Metagenome	106	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0069134_1731362	F093695	GGAG	MRKQAVKYFGWALLYMGKPFTAIGNWFWKKHRDVLDWNK*