| Basic Information | |
|---|---|
| Taxon OID | 3300004831 Open in IMG/M |
| Scaffold ID | Ga0069134_167646 Open in IMG/M |
| Source Dataset Name | Marine surface microbial communities from the North Atlantic Ocean - filtered matter |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Molecular Research LP (MR DNA) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1031 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Coastal → Unclassified → Surface Seawater → Marine Surface Microbial Communities From The North Atlantic Ocean, Enriched With Methanesulfonate |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Leca da Palmeira, Matosinhos | |||||||
| Coordinates | Lat. (o) | 41.226956 | Long. (o) | -8.720528 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F003751 | Metagenome / Metatranscriptome | 470 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0069134_1676462 | F003751 | AGGAGG | MATYKSDAGAILTPGNQINKLSAFNHEGVLGWPGIELFEQVGYVKVTNVEADKASFKSFSITVPSPDRRVSDRVRDDRTSLVVKASTARPAYVYGASIAIGQDTPSGGLPSFPASPITADLGGTTTELLLLGPDNSGSPIGVPATQLLGNAAAHSSITAASSLFLQGAGDTTTGDVPFWTSVTSTIERADAANSMMYKVTADTTFKVYNVDAITGTSVNGDGVFISADDSTAGRAAYIVCRVNYLRPA |
| ⦗Top⦘ |