Basic Information | |
---|---|
Taxon OID | 3300004831 Open in IMG/M |
Scaffold ID | Ga0069134_138649 Open in IMG/M |
Source Dataset Name | Marine surface microbial communities from the North Atlantic Ocean - filtered matter |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Molecular Research LP (MR DNA) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 676 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Coastal → Unclassified → Surface Seawater → Marine Surface Microbial Communities From The North Atlantic Ocean, Enriched With Methanesulfonate |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Leca da Palmeira, Matosinhos | |||||||
Coordinates | Lat. (o) | 41.226956 | Long. (o) | -8.720528 | Alt. (m) | Depth (m) | 0 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F038720 | Metagenome / Metatranscriptome | 165 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0069134_1386492 | F038720 | AGAAG | MDSNYKDYVLKELDNLVSQITESSEFNASETYKGLISSLQGQIDYHQECIDKCKQMLFLINAGKPQVTAYMNDDESPEARAAFDDFWKSQDVLHDSD* |
⦗Top⦘ |