| Basic Information | |
|---|---|
| Taxon OID | 3300004829 Open in IMG/M |
| Scaffold ID | Ga0068515_126386 Open in IMG/M |
| Source Dataset Name | Marine water microbial communities from the Pohang Bay, Korea with extracellular vesicles - Pohang-EVs |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Chunlab, Inc |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 725 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine Water → Marine And Wastewater Microbial Communities From Korea, With Extracellular Vesicles |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | South Korea: Pohang-si, Gyeongsangbuk-do | |||||||
| Coordinates | Lat. (o) | 36.03776 | Long. (o) | 129.386 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F061374 | Metagenome | 132 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0068515_1263862 | F061374 | N/A | GRNVGGIKAAKTINLQISYWALLEQIRSKKGFKNGNEAMCYVIMEKAKEIGLETG* |
| ⦗Top⦘ |