Basic Information | |
---|---|
Taxon OID | 3300004829 Open in IMG/M |
Scaffold ID | Ga0068515_119463 Open in IMG/M |
Source Dataset Name | Marine water microbial communities from the Pohang Bay, Korea with extracellular vesicles - Pohang-EVs |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Chunlab, Inc |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 848 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine Water → Marine And Wastewater Microbial Communities From Korea, With Extracellular Vesicles |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | South Korea: Pohang-si, Gyeongsangbuk-do | |||||||
Coordinates | Lat. (o) | 36.03776 | Long. (o) | 129.386 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F049402 | Metagenome | 146 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0068515_1194631 | F049402 | AGG | MAYNLKDVFYLSSQHTYDASTYASAGIEAAIPIDVSAYVDPIASGKRSGQGLAIYKVHANVSKDTTGTNQVAADAGAANYGLSVKPFTVSGDAISGIGAPDLSCASDLAIYLGSYTSPATSVAGQACAPTGESYLEPSAEVPYVVVRDTIYQIFETSVAMSTGDNMVVSYRMECAMVKLDSSTLNQLLRTQTA* |
⦗Top⦘ |