NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0068515_102675

Scaffold Ga0068515_102675


Overview

Basic Information
Taxon OID3300004829 Open in IMG/M
Scaffold IDGa0068515_102675 Open in IMG/M
Source Dataset NameMarine water microbial communities from the Pohang Bay, Korea with extracellular vesicles - Pohang-EVs
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterChunlab, Inc
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2291
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (60.00%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Associated Families4

Taxonomy
All Organisms → Viruses → unclassified viruses → Circular genetic element sp.(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine Water → Marine And Wastewater Microbial Communities From Korea, With Extracellular Vesicles

Source Dataset Sampling Location
Location NameSouth Korea: Pohang-si, Gyeongsangbuk-do
CoordinatesLat. (o)36.03776Long. (o)129.386Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001611Metagenome / Metatranscriptome663N
F002374Metagenome / Metatranscriptome566Y
F007722Metagenome / Metatranscriptome346Y
F013311Metagenome / Metatranscriptome272Y

Sequences

Protein IDFamilyRBSSequence
Ga0068515_1026751F007722N/AASLTGDIGTIKKSIQTLNNRINGLNSPKLNDELLQYAIKQQNNVTDIRKNNIGG*
Ga0068515_1026752F013311AGGAGGLAFLGDFGKFFGLGSSEQVLGDVGASVGSLFGPQGAIIGKQSGKALGRATSNLAGDDNISPISTADQALEQSAVSVSQRGDIPQETSTMIGTTGMPVQTAGFGMIPQAIQGIRSLAPQVGKFFGSPIGSVAIGGGSALGVNMFAGTDMRKEKPVLTQSRRNKARVRQLVNFLGIEGAASFLSQASGRNVTGSDVVALLLRTFRNDGAYITKAQVRNLRRTTNRFKSLEKQVKEATSMTRTTRRPAMRRASSTTLIKN*
Ga0068515_1026753F001611AGGAGGMPLVQKTLTLAAGATSDNILANTNYEFVDGNVRLRVASAVDTAGTSATADTFLNVSVNNAEYSKDVSVPALVSGQPFGVLNGAYLNNDLLTTGSQRNRVLVRFTNDTAATRTIRCGVFIGG*
Ga0068515_1026755F002374N/AMDQVLLYVSIILASVSFFLCLYACTRVGKLLNSVKGLDWDIIASLTGDIGTIKKSIQTLNNRINGLNSPKLNDELLQYAIKQ
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.