Scaffold Ga0071354_125895

Overview

Basic Information

• Taxon OID: 3300004826
• Scaffold ID: Ga0071354_125895
• Source Dataset Name: Microbial communities from the Yellowstone National Park, bulk metagenomes as controls for mini-metagenomic methods - Norris Mammoth Corridor Bijah Roadside hotspring 3
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Stanford University
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 615
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfovibrionales → Desulfovibrionaceae → Halodesulfovibrio → Halodesulfovibrio aestuarii (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hotspring → Microbial Communities From The Yellowstone National Park, Bulk Metagenomes As Controls For Mini-Metagenomic Methods

Source Dataset Sampling Location

• Location Name: Yellowstone National Park, Wyoming, USA
• Coordinates
  • Lat. (^o): 44.761133
  • Long. (^o): -110.7309
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F104113	Metagenome / Metatranscriptome	101	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0071354_1258951	F104113	N/A	LKRLNISILIPVSYVDGKPLRESVWTNVIISPEKAAELGLEIKAKSLKTDFQHITEEELAQYGLNVTDSGTVGLTISYDAVGLNKASARQLMSEGLPPRTVYPASSVTNIQLDTADNLITEFDTVDDVKQTEGYRPPSAVSNFVNRMFNKDKTEQPKQTMLDLSLF*