| Basic Information | |
|---|---|
| Taxon OID | 3300004824 Open in IMG/M |
| Scaffold ID | Ga0071332_101419 Open in IMG/M |
| Source Dataset Name | Chicken cecum microbial communities from Brno, Czech Republic, of chickens treated with various antibiotics - Erythromycin treated |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Masaryk University |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1008 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → PVC group → Chlamydiae → Chlamydiia → Chlamydiales → Chlamydiaceae → Chlamydia/Chlamydophila group → Chlamydia → Chlamydia abortus | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Birds → Digestive System → Ceca → Unclassified → Chicken Cecum → Chicken Cecum Microbial Communities From Brno, Czech Republic, Of Chickens Treated With Various Antibiotics |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Brno, Czech Republic | |||||||
| Coordinates | Lat. (o) | 49.19522 | Long. (o) | 16.60796 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F038012 | Metagenome | 166 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0071332_1014191 | F038012 | AGGA | MIVEFQPPCYVQDRQPLDPAAQSHIQPGLECLQAWGIHNLLGQPVPVRHHP |
| ⦗Top⦘ |