| Basic Information | |
|---|---|
| Taxon OID | 3300004822 Open in IMG/M |
| Scaffold ID | Ga0070913_101264 Open in IMG/M |
| Source Dataset Name | Hypersaline lake viral communities from Bras del Port, Santa Pola, Alicante, Spain - CR30 Febr14 dirigido |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Alicante |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 920 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → environmental samples → uncultured virus | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Hypersaline Lake → Hypersaline Lake Viral Communities From Bras Del Port, Santa Pola, Alicante, Spain |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Bras del Port, Alicante. | |||||||
| Coordinates | Lat. (o) | 38.19317 | Long. (o) | -0.59268 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F065465 | Metagenome | 127 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0070913_1012642 | F065465 | AGGA | MSEDITVVCECDVLEEARSMGYRRYADMPAADIVAAWPVHYTEHGSWDSHILPTLRCLAGYGDRGYGTYQERQDVALIQDGDEADMPADAIILDSAYLLDDIISSWQAGAHTAVTDTLRQSDSYSLEDIQR* |
| ⦗Top⦘ |