Scaffold Ga0071104_111168

Overview

Basic Information

• Taxon OID: 3300004818
• Scaffold ID: Ga0071104_111168
• Source Dataset Name: Trench sediment microbial communities from the deep Pacific Ocean
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Macrogen
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1218
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Sediment → Unclassified → Unclassified → Deep-Sea Sediment → Trench Sediment Microbial Communities From The Deep Pacific Ocean

Source Dataset Sampling Location

• Location Name: Pacific Ocean
• Coordinates
  • Lat. (^o): 29.0
  • Long. (^o): 142.0
  • Depth (m): 9800

Associated Families

Family	Category	Number of Sequences	3D Structure?
F038915	Metagenome	165	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0071104_1111682	F038915	GAG	MPSIMLKNVGAGTANALDGLQFQDIPEPGALVTIYASTPTAGGLISYSVGTERFLVAAAVNIEISADVVDTQQDLVLDREPVPPGKQFLAVDAQIGNILVVIEQLPG*