| Basic Information | |
|---|---|
| Taxon OID | 3300004818 Open in IMG/M |
| Scaffold ID | Ga0071104_110973 Open in IMG/M |
| Source Dataset Name | Trench sediment microbial communities from the deep Pacific Ocean |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Macrogen |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1411 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Sediment → Unclassified → Unclassified → Deep-Sea Sediment → Trench Sediment Microbial Communities From The Deep Pacific Ocean |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Pacific Ocean | |||||||
| Coordinates | Lat. (o) | 29.0 | Long. (o) | 142.0 | Alt. (m) | Depth (m) | 9800 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F038915 | Metagenome | 165 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0071104_1109731 | F038915 | AGGAGG | MPSIRISNAGVQANAVDGLQFQDIPEPGALVTIYASTAIALGTISYSVGTERFLVLASINIEQSADEVDTNLDMILDREPVPAGKQFLSVEGQVANFLIVIEDLPGG* |
| ⦗Top⦘ |