Basic Information | |
---|---|
Taxon OID | 3300004818 Open in IMG/M |
Scaffold ID | Ga0071104_110634 Open in IMG/M |
Source Dataset Name | Trench sediment microbial communities from the deep Pacific Ocean |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Macrogen |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 2363 |
Total Scaffold Genes | 4 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Sediment → Unclassified → Unclassified → Deep-Sea Sediment → Trench Sediment Microbial Communities From The Deep Pacific Ocean |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Pacific Ocean | |||||||
Coordinates | Lat. (o) | 29.0 | Long. (o) | 142.0 | Alt. (m) | Depth (m) | 9800 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F038915 | Metagenome | 165 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0071104_1106343 | F038915 | GGAGG | MPSIRISNAGVQANAVDGLQFQDIPAGGALVTIYASCAVALGTISYSVGTERFLVLASINIEGSADVVSTRDDMILDREPVPAGKQFLSVEGQVANFLIVIEDVPSG* |
⦗Top⦘ |