NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0071104_110434

Scaffold Ga0071104_110434


Overview

Basic Information
Taxon OID3300004818 Open in IMG/M
Scaffold IDGa0071104_110434 Open in IMG/M
Source Dataset NameTrench sediment microbial communities from the deep Pacific Ocean
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterMacrogen
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3307
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Sediment → Unclassified → Unclassified → Deep-Sea Sediment → Trench Sediment Microbial Communities From The Deep Pacific Ocean

Source Dataset Sampling Location
Location NamePacific Ocean
CoordinatesLat. (o)29.0Long. (o)142.0Alt. (m)Depth (m)9800
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F038915Metagenome165Y

Sequences

Protein IDFamilyRBSSequence
Ga0071104_1104344F038915GAGGMPSIKRANVAAGTVNDVDGLQFQDIPEPGALVSIAASTPTAGANIDFSVGTERFLVAAACNIELSADVVQRQEDLILDREPVPPGKMFLAVNAQIVNYLIIIEDLPSG*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.