Scaffold Ga0071104_104787

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0071104_104787

Scaffold Ga0071104_104787

Overview

Basic Information
Taxon OID	3300004818 Open in IMG/M
Scaffold ID	Ga0071104_104787 Open in IMG/M
Source Dataset Name	Trench sediment microbial communities from the deep Pacific Ocean
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Macrogen
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1461
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Sediment → Unclassified → Unclassified → Deep-Sea Sediment → Trench Sediment Microbial Communities From The Deep Pacific Ocean

Source Dataset Sampling Location
Location Name	Pacific Ocean
Coordinates	Lat. (^o)	29.0	Long. (^o)	142.0	Alt. (m)		Depth (m)	9800
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F038915	Metagenome	165	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0071104_1047873	F038915	AGGAG	VPSIRISNAGVQANAVDGLQFQDIPEPGALVSIYATTAVATGTISYSVGTERFLVLASVNIEASADEVLTNRDMILDREPVPAGKQFLSVEGQVANFLIVIEDLPG*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.