NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0062381_10182842

Scaffold Ga0062381_10182842


Overview

Basic Information
Taxon OID3300004808 Open in IMG/M
Scaffold IDGa0062381_10182842 Open in IMG/M
Source Dataset NameWetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare1Fresh
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)718
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment → Wetland Sediment Microbial Communities From St. Louis River Estuary, Michigan Under Dissolved Organic Matter Induced Mercury Methylation

Source Dataset Sampling Location
Location NameUSA: Michigan, St. Louis River estuary
CoordinatesLat. (o)46.6972164Long. (o)-92.3279105Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001196Metagenome / Metatranscriptome749Y

Sequences

Protein IDFamilyRBSSequence
Ga0062381_101828421F001196GGAGMRRTAILTFAAGLSLLAAQTAGAGAVGDQFRGGAFGLPWNASKSAIEAKYPGGKWDQNEKGLARYCAASKQMLLKLPAQHQTRELCFLIGSDGTMASVTARMEPTLPALLAIVNRSRTMFGDFDAVRRDEGAIQSRHTNMLWMKEAPLVVQVSSGNDPDGRPNEVSFTIAD

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.