| Basic Information | |
|---|---|
| Taxon OID | 3300004801 Open in IMG/M |
| Scaffold ID | Ga0058860_12242863 Open in IMG/M |
| Source Dataset Name | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 842 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → Switchgrass Rhizosphere And Bulk Soil Microbial Communities From Kellogg Biological Station, Michigan, Usa For Expression Studies |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Kellogg Biological Station, Michigan, USA | |||||||
| Coordinates | Lat. (o) | 42.3912 | Long. (o) | -85.383786 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F019303 | Metagenome / Metatranscriptome | 230 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0058860_122428631 | F019303 | N/A | AMTEYATHRFSVGQHVAGSGNSPGAYEVIALIAGRDGPEYQIRSLEGGRQAVVPERGLTYARASARSAPEASP* |
| ⦗Top⦘ |