Scaffold Ga0058860_12137909

Overview

Basic Information

• Taxon OID: 3300004801
• Scaffold ID: Ga0058860_12137909
• Source Dataset Name: Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 565
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → Switchgrass Rhizosphere And Bulk Soil Microbial Communities From Kellogg Biological Station, Michigan, Usa For Expression Studies

Source Dataset Sampling Location

• Location Name: Kellogg Biological Station, Michigan, USA
• Coordinates
  • Lat. (^o): 42.3912
  • Long. (^o): -85.383786

Associated Families

Family	Category	Number of Sequences	3D Structure?
F047932	Metagenome / Metatranscriptome	149	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0058860_121379092	F047932	N/A	RAVNKRIRLMWIAALASAAWVNRKDVVRWANFAKRAVRQRNARPVSDLVTEAKVRAAVTADPVLRRDPALTDLAVHDGVVTLLTSSAGWPEHETHVRRLLKINGITDVKALNFADS*