| Basic Information | |
|---|---|
| Taxon OID | 3300004791 Open in IMG/M |
| Scaffold ID | Ga0068459_114283 Open in IMG/M |
| Source Dataset Name | Porphyra umbilicalis microbial communities from the coast of Maine, USA, in Atlantic Ocean |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | HudsonAlpha Institute for Biotechnology |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1383 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Rhodophyta → Bangiophyceae → Bangiales → Bangiaceae → Porphyra → Porphyra umbilicalis | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Algae → Red Algae → Unclassified → Unclassified → Porphyra Umbilicalis → Porphyra Umbilicalis Symbiont Microbial Communities From The Coast Of Maine, Usa, In Atlantic Ocean |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Trenton, Maine, United States | |||||||
| Coordinates | Lat. (o) | 44.4 | Long. (o) | -68.4 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F088156 | Metagenome | 109 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0068459_1142832 | F088156 | N/A | MERASPDAFLADNSLIPACWPCSVDLSDSPDLGASLFQVLGVKGLQRQSSCANWSFNEGCPKSGFPHRGLHGGLFHVFIGNVVPFSSCTNCQHMPALVFVHLIGPRDRHLPKLQ* |
| ⦗Top⦘ |