Scaffold Ga0007758_10101347

Overview

Basic Information

• Taxon OID: 3300004790
• Scaffold ID: Ga0007758_10101347
• Source Dataset Name: Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1429
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Freshwater Lake Microbial Communities From The Great Lakes, Usa, Analyzing Microbial Food Webs And Carbon Cycling

Source Dataset Sampling Location

• Location Name: Lake Michigan, USA
• Coordinates
  • Lat. (^o): 43.1998
  • Long. (^o): -86.5698

Associated Families

Family	Category	Number of Sequences	3D Structure?
F029564	Metagenome / Metatranscriptome	188	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0007758_101013471	F029564	GGA	LNGQNITNNNLKNLVRDTQSPVTQELIQLESDLDKKDSDGAFALLGNNVTFGALKNLITDKPSPITVKLADKKDSDGAFALLGNNVTFGALKNLITDKPSPITVKLADKKDSDGAFALLGNNVTFGALKNLITDKPSPITVKLADKKDSDGAFALLGNNVTFGALKNLITDKPSPITVKLADKKDSDGAFALLGNNVTFGALKNLITDKPSPITVKLADK