| Basic Information | |
|---|---|
| Taxon OID | 3300004757 Open in IMG/M |
| Scaffold ID | Ga0068409_13055 Open in IMG/M |
| Source Dataset Name | Marine sediment microbial communities from Formosa Ridge, offshore Taiwan - G2-2 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Beijing Genomics Institute (BGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 834 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Cold Seeps → Sediment → Marine Sediment → Metagenomics Analysis Of Sediments Collected From Formosa Ridge |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | South China Sea, offshore SW Taiwan | |||||||
| Coordinates | Lat. (o) | 22.10811667 | Long. (o) | 119.29126667 | Alt. (m) | Depth (m) | 1162 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F021240 | Metagenome | 219 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0068409_130551 | F021240 | AGG | MLDFNNSQSKIVNIDREGKALQRCNLSARPMPEDGQGRMLSHMLLPSRSSFGYKAINLLSWCEAPIRVKQAKSSAPVGHMSVLS |
| ⦗Top⦘ |