NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0049107_10028273

Scaffold Ga0049107_10028273


Overview

Basic Information
Taxon OID3300004632 Open in IMG/M
Scaffold IDGa0049107_10028273 Open in IMG/M
Source Dataset NameMarine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius ilvae PIANOSA.1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3559
Total Scaffold Genes9 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (33.33%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Opisthokonta(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Annelida → Digestive System → Unclassified → Unclassified → Marine Gutless Worms Symbiont → Marine Gutless Worms Symbiont Microbial Communities From Various Locations

Source Dataset Sampling Location
Location NameGermany: Marburg
CoordinatesLat. (o)50.8Long. (o)8.81Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003723Metagenome472Y

Sequences

Protein IDFamilyRBSSequence
Ga0049107_100282739F003723N/AVEVAKALGGSFKLVTLAPRTVREMTQLPKETQKNGDTNKSF*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.