| Basic Information | |
|---|---|
| Taxon OID | 3300004630 Open in IMG/M |
| Scaffold ID | Ga0049105_1362789 Open in IMG/M |
| Source Dataset Name | Worm MetaG Olavius vacuus BAHAMAS.1 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 551 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Annelida → Digestive System → Unclassified → Unclassified → Marine Gutless Worms Symbiont → Marine Gutless Worms Symbiont Microbial Communities From Various Locations |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Germany: Marburg | |||||||
| Coordinates | Lat. (o) | 50.8 | Long. (o) | 8.81 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F000027 | Metagenome | 5489 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0049105_13627892 | F000027 | AGGA | MSFRLVSNSVTLNNLERRNRPNGCVISPNSVAFWADCVKVVEDTLILVVEDTAEM* |
| ⦗Top⦘ |