| Basic Information | |
|---|---|
| Taxon OID | 3300004630 Open in IMG/M |
| Scaffold ID | Ga0049105_1003569 Open in IMG/M |
| Source Dataset Name | Worm MetaG Olavius vacuus BAHAMAS.1 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 8306 |
| Total Scaffold Genes | 10 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 4 (40.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Annelida → Digestive System → Unclassified → Unclassified → Marine Gutless Worms Symbiont → Marine Gutless Worms Symbiont Microbial Communities From Various Locations |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Germany: Marburg | |||||||
| Coordinates | Lat. (o) | 50.8 | Long. (o) | 8.81 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F003742 | Metagenome | 471 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0049105_10035693 | F003742 | N/A | MCAPNKTKKGNKTFSYLFCTHLAITVSAMVSGRLGAMPRMEVFLYQA* |
| ⦗Top⦘ |