Basic Information | |
---|---|
Taxon OID | 3300004626 Open in IMG/M |
Scaffold ID | Ga0066188_1197965 Open in IMG/M |
Source Dataset Name | Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius loisae HERON ISLAND.2 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 714 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Eukaryota → Opisthokonta | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Host-Associated → Annelida → Digestive System → Unclassified → Unclassified → Marine Gutless Worms Symbiont → Marine Gutless Worms Symbiont Microbial Communities From Various Locations |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Germany: Marburg | |||||||
Coordinates | Lat. (o) | 50.8 | Long. (o) | 8.81 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F004996 | Metagenome | 415 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0066188_11979651 | F004996 | N/A | MYNRNVKSKRILTKFRVLDYEYICNRIAKFHKKILFIT*VINIQILTTKYFSFQYSVTYCSQALRRPA |
⦗Top⦘ |