| Basic Information | |
|---|---|
| Taxon OID | 3300004626 Open in IMG/M |
| Scaffold ID | Ga0066188_1037178 Open in IMG/M |
| Source Dataset Name | Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius loisae HERON ISLAND.2 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1487 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Cladistia → Polypteriformes → Polypteridae → Polypterus → Polypterus senegalus | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Annelida → Digestive System → Unclassified → Unclassified → Marine Gutless Worms Symbiont → Marine Gutless Worms Symbiont Microbial Communities From Various Locations |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Germany: Marburg | |||||||
| Coordinates | Lat. (o) | 50.8 | Long. (o) | 8.81 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F008295 | Metagenome | 335 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0066188_10371783 | F008295 | GGA | MQDRVYQKNVKDVNKLRERLVEVWAGLQQNVIDDAIDQWRRRLRACVRAR |
| ⦗Top⦘ |