Scaffold Ga0068923_1150436

Overview

Basic Information

• Taxon OID: 3300004504
• Scaffold ID: Ga0068923_1150436
• Source Dataset Name: Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 8 (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 536
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Aquisphaera (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil → Peatlands Soil Microbial Communities From Germany And Austria, That Are Sulfate Reducing

Source Dataset Sampling Location

• Location Name: Germany: Weissenstadt
• Coordinates
  • Lat. (^o): 50.13
  • Long. (^o): 11.88

Associated Families

Family	Category	Number of Sequences	3D Structure?
F046221	Metagenome / Metatranscriptome	151	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0068923_11504361	F046221	AGGAG	MSSDKSNEEVSSATDPARDFLEFWRNYFEQTAIQTRILLEGMQGGKSLDQLHTQGLASLSQSLDSFMRTPAFLEALKQSLKRMIDLKLMQDQVAQAVSQQTGLPLKADITGLFERVHSAEQTILKQL