| Basic Information | |
|---|---|
| Taxon OID | 3300004481 Open in IMG/M |
| Scaffold ID | Ga0069718_16076063 Open in IMG/M |
| Source Dataset Name | Combined Assembly of Gp0112041, Gp0112042, Gp0112043 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | The National High-throughput DNA Sequencing Centre |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1358 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment → Urban Pond Sediment Microbial Communities From Copenhagen, Denmark |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Copenhagen, Denmark | |||||||
| Coordinates | Lat. (o) | 55.685937 | Long. (o) | 12.574205 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F032653 | Metagenome | 179 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0069718_160760634 | F032653 | N/A | PYFYSTTIHIDCKFGGYCFWCNGDKILLQNDQKTKMRLILLALLLTSCASVKKFEKRYDSTGTTKVDSVHLVFYDSVTKIIEKEQVFTKTITIYDTIRIAKDSIIVVPKVVTQWIYETREKQTDNSLVKKDTIAFNRTETAQISIVDKNKVTTQNNFWKALIGLIIAIVLILAYWSRLWK |
| ⦗Top⦘ |