Scaffold Ga0062595_100110432

Overview

Basic Information

• Taxon OID: 3300004479
• Scaffold ID: Ga0062595_100110432
• Source Dataset Name: Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1491
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil → Soil Microbial Communities From Arlington Agricultural Research Station In Wisconsin And Kellogg Biological Station In Michigan, Replicating The Bioenergy Cropping Systems Trials (Bcsts)

Source Dataset Sampling Location

• Location Name: Wisconsin, United States
• Coordinates
  • Lat. (^o): 43.56
  • Long. (^o): -89.32
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F046056	Metagenome / Metatranscriptome	152	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0062595_1001104322	F046056	AGGGGG	VESGKISYAGVGAAVAGVIGIVGVYSAWWETPTATYNGTADISGTLAFVMGLAVFAFGGAYVLIADPQIRRAMGALATLCAVVLGLSCIWGISRADNVAPGATTSSGLFVSGLGAVLGIAAGFLVMRDNMQRDAEVASGGTPAPASDMPPETSTDEAGA*