| Basic Information | |
|---|---|
| Taxon OID | 3300004476 Open in IMG/M |
| Scaffold ID | Ga0068966_1390187 Open in IMG/M |
| Source Dataset Name | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 58 (Metagenome Metatranscriptome) |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 527 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil → Peatlands Soil Microbial Communities From Germany And Austria, That Are Sulfate Reducing |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Germany: Weissenstadt | |||||||
| Coordinates | Lat. (o) | 50.13 | Long. (o) | 11.88 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F026818 | Metagenome / Metatranscriptome | 196 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0068966_13901871 | F026818 | N/A | DSVGKKFALLWYLAIAIQLPVSQATSHTRSIAIGKFTYLGTGAQTSDSTVLGVSSYELRLDTTGITMEPIPFSNVILFVKGTKQGSGAITTGLGCGQPPYQSPCKLLFLGGPSSAGFILAPCARLNKEQDWTQTCISIAVQLVSLTGKNFSFALANGKQFCAYGINNIFLLPKPD |
| ⦗Top⦘ |