Scaffold Ga0063356_102515617

Overview

Basic Information

• Taxon OID: 3300004463
• Scaffold ID: Ga0063356_102515617
• Source Dataset Name: Combined assembly of Arabidopsis thaliana microbial communities
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 789
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere → Arabidopsis Thaliana Rhizosphere Microbial Communities From The Joint Genome Institute, Usa, That Affect Carbon Cycling

Source Dataset Sampling Location

• Location Name: USA: Walnut Creek, California
• Coordinates
  • Lat. (^o): 37.931388
  • Long. (^o): -122.021761

Associated Families

Family	Category	Number of Sequences	3D Structure?
F089354	Metagenome	109	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0063356_1025156171	F089354	N/A	MRFYFLSLSTLMSCALLATTVFAQDLDPKDVITSLEQALPIAIAKAKAEFPDLDDYILYSVHPRVLKADPNGLHWEFVWKARAFPHHKALIVRVHMKDGSAVAEREKV