Scaffold Ga0066223_1307127

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0066223_1307127

Scaffold Ga0066223_1307127

Overview

Basic Information
Taxon OID	3300004461 Open in IMG/M
Scaffold ID	Ga0066223_1307127 Open in IMG/M
Source Dataset Name	Marine viral communities from Newfoundland, Canada BC-2
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Yale University
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	533
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae → Bacillus → Bacillus cereus group → Bacillus cereus	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Marine → Marine Viral Communities From Newfoundland, Canada

Source Dataset Sampling Location
Location Name	Newfoundland, Canada
Coordinates	Lat. (^o)	47.593411	Long. (^o)	-52.885466	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F022109	Metagenome	216	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0066223_13071271	F022109	GGAG	MRYLEIESIWDKNGDSILNRRSEHQELTFRVNYGKGTSKCYLFEDQAEDKIWIMSVGACIKSHYSEADYAETERLSKTLPLNDGDVIRIRARYGKQYKVHVNGNYSDLGYLVPINK*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.