NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0066223_1192421

Scaffold Ga0066223_1192421


Overview

Basic Information
Taxon OID3300004461 Open in IMG/M
Scaffold IDGa0066223_1192421 Open in IMG/M
Source Dataset NameMarine viral communities from Newfoundland, Canada BC-2
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterYale University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)546
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Marine → Marine Viral Communities From Newfoundland, Canada

Source Dataset Sampling Location
Location NameNewfoundland, Canada
CoordinatesLat. (o)47.593411Long. (o)-52.885466Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F087764Metagenome110N

Sequences

Protein IDFamilyRBSSequence
Ga0066223_11924212F087764AGGAMKRPTISEAKTFFYQNAPFVMDEYEDMKKDYGEFFAARYIIEILIDYNKNEKDKVIGG*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.