| Basic Information | |
|---|---|
| Taxon OID | 3300004460 Open in IMG/M |
| Scaffold ID | Ga0066222_1061034 Open in IMG/M |
| Source Dataset Name | Marine viral communities from Newfoundland, Canada BC-1 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Yale University |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 738 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (75.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Coastal → Unclassified → Marine → Marine Viral Communities From Newfoundland, Canada |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Newfoundland, Canada | |||||||
| Coordinates | Lat. (o) | 47.593411 | Long. (o) | -52.885466 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F054777 | Metagenome / Metatranscriptome | 139 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0066222_10610343 | F054777 | GGAGG | MTNKINDETLERLYEDVVADDEAGLIDDDVNEIAHLYNLHADDDRDEILQFIAENEFYKQFT* |
| ⦗Top⦘ |