NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0066224_1054643

Scaffold Ga0066224_1054643


Overview

Basic Information
Taxon OID3300004457 Open in IMG/M
Scaffold IDGa0066224_1054643 Open in IMG/M
Source Dataset NameMarine viral communities from Newfoundland, Canada MC-1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterYale University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2678
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (66.67%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Marine → Marine Viral Communities From Newfoundland, Canada

Source Dataset Sampling Location
Location NameNewfoundland, CA
CoordinatesLat. (o)47.65117Long. (o)-52.695961Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F029935Metagenome / Metatranscriptome187Y
F033503Metagenome / Metatranscriptome177Y
F051178Metagenome / Metatranscriptome144N

Sequences

Protein IDFamilyRBSSequence
Ga0066224_10546432F029935AGGAMNKTLEKDYENMKDKVDKLLGQIDTLVCDFDEKYDVNVANDLHYKLDEVADLIEDNNINTDFDE*
Ga0066224_10546435F033503AGGAGMKDTQLKKDILKLALAESATDCTIMCGTLFAKFNVSIHEQMANNLKKTLQTFFDKRKKNDCNVQMSCPLPDNEYAYDFHPIVDFRHDGMGI*
Ga0066224_10546436F051178N/ANMKKGKCNVCSKVFTPKKDVSIRGRLGPIPVDLCKGCLPKVLKHDELTLNDTRR*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.