NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0065861_1141407

Scaffold Ga0065861_1141407


Overview

Basic Information
Taxon OID3300004448 Open in IMG/M
Scaffold IDGa0065861_1141407 Open in IMG/M
Source Dataset NameMarine viral communities from Newfoundland, Canada BC-1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterYale University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)616
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Marine → Marine Viral Communities From Newfoundland, Canada

Source Dataset Sampling Location
Location NameNewfoundland, Canada
CoordinatesLat. (o)47.593411Long. (o)-52.885466Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F012284Metagenome282Y

Sequences

Protein IDFamilyRBSSequence
Ga0065861_11414071F012284GGAGMKRYQIEASTFELDGTESHKVLYTSNGISTARAYLEGFTNASDWKDYDLVNLLDTAHPSDSHLHLIDSKMHPSIDNGATSQSLADFAEVWPDMTSWSRL*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.