| Basic Information | |
|---|---|
| Taxon OID | 3300004383 Open in IMG/M |
| Scaffold ID | Ga0064591_10039926 Open in IMG/M |
| Source Dataset Name | Marine microbial communities from Bothnian Bay, Baltic Sea |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Gottingen |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 547 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine Sediment → Marine Microbial Communities From Bothnian Bay, Baltic Sea |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Bothnian Bay, Baltic Sea | |||||||
| Coordinates | Lat. (o) | 65.4530556 | Long. (o) | 23.3088889 | Alt. (m) | Depth (m) | 75 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F010462 | Metagenome / Metatranscriptome | 303 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0064591_100399261 | F010462 | N/A | MLYQLPNGKVVHLSIEEYLSLTDLDIQFLMSIDYGEHILDPFTGSAVEKNTREKYIDTDFLPLEDYDLNDIPSDDLPFDDIIDLQDPLDN* |
| ⦗Top⦘ |