Scaffold Ga0064591_10039867

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0064591_10039867

Scaffold Ga0064591_10039867

Overview

Basic Information
Taxon OID	3300004383 Open in IMG/M
Scaffold ID	Ga0064591_10039867 Open in IMG/M
Source Dataset Name	Marine microbial communities from Bothnian Bay, Baltic Sea
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Gottingen
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1038
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine Sediment → Marine Microbial Communities From Bothnian Bay, Baltic Sea

Source Dataset Sampling Location
Location Name	Bothnian Bay, Baltic Sea
Coordinates	Lat. (^o)	65.4530556	Long. (^o)	23.3088889	Alt. (m)		Depth (m)	75
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F095347	Metagenome / Metatranscriptome	105	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0064591_100398673	F095347	N/A	IFMYLQAAKSKVEFCLEPQKGMSLYNYALKLLNKMECTNC*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.