Scaffold Ga0064591_10006469

Overview

Basic Information

• Taxon OID: 3300004383
• Scaffold ID: Ga0064591_10006469
• Source Dataset Name: Marine microbial communities from Bothnian Bay, Baltic Sea
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Gottingen
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 652
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine Sediment → Marine Microbial Communities From Bothnian Bay, Baltic Sea

Source Dataset Sampling Location

• Location Name: Bothnian Bay, Baltic Sea
• Coordinates
  • Lat. (^o): 65.4530556
  • Long. (^o): 23.3088889
  • Depth (m): 75

Associated Families

Family	Category	Number of Sequences	3D Structure?
F015265	Metagenome / Metatranscriptome	256	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0064591_100064692	F015265	N/A	MFPDFITKSSTMYPAHITKNPALIEKNAIVNLNNVGLPVFRNPINDIIPIESPTKNPIKLSIFSNRNSNDD*