NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0065726_17360

Scaffold Ga0065726_17360


Overview

Basic Information
Taxon OID3300004369 Open in IMG/M
Scaffold IDGa0065726_17360 Open in IMG/M
Source Dataset NameSaline microbial communities from the South Caspian sea - cas-15
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterBeijing Genomics Institute (BGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)11564
Total Scaffold Genes18 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)16 (88.89%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C455(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline → Saline Microbial Communities From The South Caspian Sea

Source Dataset Sampling Location
Location NameCaspian Sea
CoordinatesLat. (o)41.916215Long. (o)50.672019Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F073466Metagenome / Metatranscriptome120N

Sequences

Protein IDFamilyRBSSequence
Ga0065726_1736015F073466AGGMATGVAGSTLVGELNRLAGITDIKQFQDAQGAANAWAGTTGLALLGALNEEAQAGRSPKDFKGLNAVCNEIAGTTGLEAIPALRSIDV*QH*MNLLMRFS*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.