Scaffold Ga0065726_12822

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0065726_12822

Scaffold Ga0065726_12822

Overview

Basic Information
Taxon OID	3300004369 Open in IMG/M
Scaffold ID	Ga0065726_12822 Open in IMG/M
Source Dataset Name	Saline microbial communities from the South Caspian sea - cas-15
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Beijing Genomics Institute (BGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	22807
Total Scaffold Genes	28 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	25 (89.29%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline → Saline Microbial Communities From The South Caspian Sea

Source Dataset Sampling Location
Location Name	Caspian Sea
Coordinates	Lat. (^o)	41.916215	Long. (^o)	50.672019	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F084166	Metagenome / Metatranscriptome	112	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0065726_1282212	F084166	AGGAG	MVGKIGIKDYVEHKDGSATLTFECDDEAKKALINEGLISLLEKAVSEHHPEYKATEGEGRWRT*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.