| Basic Information | |
|---|---|
| Taxon OID | 3300004369 Open in IMG/M |
| Scaffold ID | Ga0065726_12822 Open in IMG/M |
| Source Dataset Name | Saline microbial communities from the South Caspian sea - cas-15 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Beijing Genomics Institute (BGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 22807 |
| Total Scaffold Genes | 28 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 25 (89.29%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline → Saline Microbial Communities From The South Caspian Sea |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Caspian Sea | |||||||
| Coordinates | Lat. (o) | 41.916215 | Long. (o) | 50.672019 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F084166 | Metagenome / Metatranscriptome | 112 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0065726_1282212 | F084166 | AGGAG | MVGKIGIKDYVEHKDGSATLTFECDDEAKKALINEGLISLLEKAVSEHHPEYKATEGEGRWRT* |
| ⦗Top⦘ |