Scaffold Ga0065726_10065

Overview

Basic Information

• Taxon OID: 3300004369
• Scaffold ID: Ga0065726_10065
• Source Dataset Name: Saline microbial communities from the South Caspian sea - cas-15
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Beijing Genomics Institute (BGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 138068
• Total Scaffold Genes: 141
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 119 (84.40%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline → Saline Microbial Communities From The South Caspian Sea

Source Dataset Sampling Location

• Location Name: Caspian Sea
• Coordinates
  • Lat. (^o): 41.916215
  • Long. (^o): 50.672019

Associated Families

Family	Category	Number of Sequences	3D Structure?
F070044	Metagenome / Metatranscriptome	123	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0065726_10065128	F070044	N/A	MVTSCMDSGVQKPIGLSEAKITGFTDKALFESALARKSKLQKLVWVTNRTAFVRRALSGTIITMLIGAVIGAAITISSMWVLA*