| Basic Information | |
|---|---|
| Taxon OID | 3300004282 Open in IMG/M |
| Scaffold ID | Ga0066599_101014828 Open in IMG/M |
| Source Dataset Name | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Initial sediment |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 604 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Pond → Sediment → Freshwater → Freshwater Pond Sediment Microbial Communities From The University Of Edinburgh, Under Environmental Carbon Perturbations |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Crawford Collection of the Royal Observatory Edinburgh | |||||||
| Coordinates | Lat. (o) | 55.9232 | Long. (o) | -3.1878 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F016394 | Metagenome | 247 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0066599_1010148282 | F016394 | GGAG | VSKKTGTIWRKKETMQTEELTCLAKKIRDSLPNVEAFPLSTIYTTIKEQEKMKMNLPDFKELIYHLTGWDISLQVIRRQLEINHIVW* |
| ⦗Top⦘ |