Basic Information | |
---|---|
Taxon OID | 3300004268 Open in IMG/M |
Scaffold ID | Ga0066398_10058157 Open in IMG/M |
Source Dataset Name | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 802 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil → Tropical Forest Soil Microbial Communities From Panama Analyzed To Predict Greenhouse Gas Emissions |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Panama: Oeste | |||||||
Coordinates | Lat. (o) | 9.1086 | Long. (o) | -79.8436 | Alt. (m) | Depth (m) | 0 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F040170 | Metagenome / Metatranscriptome | 162 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0066398_100581571 | F040170 | GAG | LLYEDETILWRFALPRLGWWRRAQRPRLPTRPLSQSQSKREESLKRQAWL |
⦗Top⦘ |