NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0066396_10000702

Scaffold Ga0066396_10000702


Overview

Basic Information
Taxon OID3300004267 Open in IMG/M
Scaffold IDGa0066396_10000702 Open in IMG/M
Source Dataset NameTropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 6 MoBio
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2651
Total Scaffold Genes10 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (40.00%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil → Tropical Forest Soil Microbial Communities From Panama Analyzed To Predict Greenhouse Gas Emissions

Source Dataset Sampling Location
Location NamePanama: Oeste
CoordinatesLat. (o)9.1086Long. (o)-79.8436Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000284Metagenome / Metatranscriptome1378Y
F001481Metagenome / Metatranscriptome687Y
F003919Metagenome / Metatranscriptome462Y
F027001Metagenome / Metatranscriptome196Y

Sequences

Protein IDFamilyRBSSequence
Ga0066396_100007021F027001N/AYSHCVVIHFAAHPPSKFWPKGVTAFSRAEWAGSLALAERSARRWRKEQYVEAIEILEARQV*
Ga0066396_1000070210F000284GAGGMLLRTSVAVFAAAISLGLWSGASNTVLAHDIYSNLRDRDGHFCCNGQDCRPVQVTVLPNGSYYLPTTNEIIPADRATPSPDDRFHHCTYSATAYDFEPDGGPMSGGGGIGGEVTR
Ga0066396_100007026F003919AGGMNFVPPDTCLQDYQKRRSAFLNELIASTPNVSLRAKEFRRWIDENSAYSDNDEA*
Ga0066396_100007027F001481N/AMTKLKRSVDPSSLDADWPPHQEIAIADLVAEARAADWDFTNWCLASGYDASDPDARRMFECLLAYARFEGGAGLH*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.