NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0062590_101509718

Scaffold Ga0062590_101509718


Overview

Basic Information
Taxon OID3300004157 Open in IMG/M
Scaffold IDGa0062590_101509718 Open in IMG/M
Source Dataset NameSoil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)674
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Agrobacterium → Agrobacterium rhizogenes(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil → Soil Microbial Communities From Arlington Agricultural Research Station In Wisconsin And Kellogg Biological Station In Michigan, Replicating The Bioenergy Cropping Systems Trials (Bcsts)

Source Dataset Sampling Location
Location NameWisconsin, United States
CoordinatesLat. (o)43.2958Long. (o)-89.3799Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005292Metagenome / Metatranscriptome405Y

Sequences

Protein IDFamilyRBSSequence
Ga0062590_1015097181F005292N/AMSFELVNQSTVICRTFSKQFWAKALELAISYGWQPMGTQPPSHLDFSKLEADWHGTYLTNDGQIVKAEDARALARALEKSLNDISDTNIRIDWNAAWSVEDDLPEWLSPEEREMLEDELQLGLLDIMGVHPFEIFAGDEKRHLKEFIRFCHLGSFEIL*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.