| Basic Information | |
|---|---|
| Taxon OID | 3300004153 Open in IMG/M |
| Scaffold ID | Ga0063455_100007499 Open in IMG/M |
| Source Dataset Name | Grasslands soil microbial communities from Hopland, California, USA (version 2) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2309 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp. | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Loam → Grasslands → Soil → Soil Microbial Communities From Mediterranean Grasslands, California |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Hopland, California | |||||||
| Coordinates | Lat. (o) | 38.99297339 | Long. (o) | -123.0674491 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F086025 | Metagenome | 111 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0063455_1000074991 | F086025 | N/A | MKLQVIRSKGRLTRLFVNVPVALASALDMQPGERLRWQLLNRSDLRLIRLGRSAPQKSPKK* |
| ⦗Top⦘ |