NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0062386_101205601

Scaffold Ga0062386_101205601


Overview

Basic Information
Taxon OID3300004152 Open in IMG/M
Scaffold IDGa0062386_101205601 Open in IMG/M
Source Dataset NameCoassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)629
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil → Bog Forest Soil Microbial Communities From Calvert Island, British Columbia, Canada

Source Dataset Sampling Location
Location NameCalvert Island, British Columbia, Canada
CoordinatesLat. (o)51.62Long. (o)-128.09Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F017589Metagenome239Y
F022573Metagenome / Metatranscriptome213N

Sequences

Protein IDFamilyRBSSequence
Ga0062386_1012056011F017589N/AMPGNLIQSEPNGVMPASLCTAFTELREFSELQNQFHDGTIQRSQLAQTSRRNFRLRKRLNAAALAVLYNFWLSQNGGLTSFAFYNPFDITAGHQIGSNYD
Ga0062386_1012056012F022573N/ALVEQAGKLYQQATYQDGQARTYASTIPTLGGIASGTYPTPGGPTTAGGTGGPTYLSLNISGSDTANFMTGNYVTPQFVTDQSMAAQNSSYGRTQQSANMQVPGLTIA*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.